Chicken Secondary Antibodies
Kingfisher Biotech Inc Chicken IL-21 Recombinant Protein
The Chicken IL-21 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken IL-21 applications are for cell culture, ELISA standard, and Western Blot Control. The Chicken IL-21 yeast-derived recombinant protein can be purchased in multiple sizes. Chicken IL-21 Specifications: (Molecular Weight: 14.2 kDa) (Amino Acid Sequence: ATSPKAMKYK QLSKTIDHLK DVVKDKDVEL LHTPENPGDG CLLTAVTCFQ NGILKLQPKN SQVNATFAKT VKILRRPFLP VSEGHCESSC ESYERKKPQE FLNSFSKLMQ KLFKNSTAER YGKSTI (126)) (Gene ID: 554218). For research use only. Made in the USA
Kingfisher Biotech Inc Chicken IFN alpha Recombinant Protein
The Chicken IFN alpha yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken IFN alpha applications are for cell culture, ELISA standard, and Western Blot Control. The Chicken IFN alpha yeast-derived recombinant protein can be purchased in multiple sizes. Chicken IFN alpha Specifications: (Molecular Weight: 19.0 kDa) (Amino Acid Sequence: CNHLRPQDAT FSHDSLQLLR DMAPTLPQLC PQHNASCSFN DTILDTSNTR QADKTTHDIL QHLFKILSSP STPAHWNDSQ RQSLLNRIHR YTQHLEQCLD SSDTRSRTRW PRNLHLTIKK HFSCLHTFLQ DNDYSACAWE HVRLQARAWF LHIHNLTGNT RT (162)) (Gene ID: 396398). For research use only. Made in the USA
Kingfisher Biotech Inc Chicken CCL4 Recombinant Protein
The Chicken CCL4 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken CCL4 applications are for cell culture, ELISA standard, and Western Blot Control. The Chicken CCL4 yeast-derived recombinant protein can be purchased in multiple sizes. Chicken CCL4 Specifications: (Molecular Weight: 7.8 kDa) (Amino Acid Sequence: APVGSDPPTSCCFTYISRQLPFSFVADYYETNSQCPHAGVVFITRKGREVCANPENDWVQDYMNKMELN) (Gene ID: 395551). For research use only. Made in the USA
Kingfisher Biotech Inc Chicken IFN gamma Recombinant Protein
The Chicken IFN gamma yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken IFN gamma applications are for cell culture, ELISA standard, and Western Blot Control. The Chicken IFN gamma yeast-derived recombinant protein can be purchased in multiple sizes. Chicken IFN gamma Specifications: (Molecular Weight: 16.7 kDa) (Amino Acid Sequence: HTASSLNLVQ LQDDIDKLKA DFNSSHSDVA DGGPIIVEKL KNWTERNEKR IILSQIVSMY LEMLENTDKS KPHTKHISEE LYTLKNNLPD GVKKVKDIMD LAKLPMNDLR IQRKAANELF SILQKLVDPP SFKRKRSQSQ RRCNC (145)) (Gene ID: 396054). For research use only. Made in the USA
Immunoreagents Inc CHICKEN A-MOUSE IGG DYLIGHT550
Secondary Antibody; Chicken anti-mouse IgG (H&L) - Affinity Pure, min x w/Hu or Rb IgG/Serum Proteins, DyLight 550 Conjugate, Host: Chicken, Format: Lyo, Label: DyL550, Applications: WB, ELISA, IHC/ICC, IF, IP, FC, FACS
Immunoreagents Inc CHICKEN A-RABBIT IGG BIO
Secondary Antibody; Chicken anti-rabbit IgG (H&L) - Affinity Pure, min x w/Hu or Mu IgG, Biotin Conjugate, Host: Chicken, Format: Liq, Label: Biotin, Applications: WB, ELISA, IHC/ICC
Immunoreagents Inc CHICKEN A-RAT IGG HRP
Secondary Antibody; Chicken anti-rat IgG (H&L) - Affinity Pure, min x w/Hu or Rb IgG or Serum Proteins, HRP Conjugate, Host: Chicken, Format: Lyo, Label: HRP, Applications: WB, ELISA, IHC/ICC
Immunoreagents Inc CHICKEN A-RABBIT IGG DYLIT594
Secondary Antibody; Chicken anti-rabbit IgG (H&L) - Affinity Pure, DyLight 594 Conjugate, Host: Chicken, Format: Lyo, Label: DyL594, Applications: WB, ELISA, IHC/ICC, IF, IP, FC, FACS
Abcam Chicken Anti-Mouse IgG H&L (FITC).
Chicken Anti-Mouse IgG H&L (FITC).
The product is subject to the following: Abcam Restricted Use Statement
Cayman Chemical AB-CHMINACA metabolIte M6 1mg
15(S)-15-methyl PGE1 is a metabolically stable synthetic analog of PGE1. In sharp contrast to the bronchodilatory effects of PGE1 15(S)-15-methyl PGE1 is a weak constrictor of human respiratory tract smooth muscle.{2218}
Cayman Chemical AB-CHMINACA metabolIte M4 1mg
Immunogen Methylated KLH Host Rabbit Species reactivity ( ) Species independent Applications ELISA ICC IF IP WB Lysine can be methylated once twice or three times by lysine methyltransferases. The transfer of methyl groups from SAM to histones is catalyzed by histone methyltransferases.
Cayman Chemical 3 5-AB-CHMFUPPYCA 1mg
An inverse agonist of LRH-1 (IC50 3.7 UM) with maximum efficacy of 64 repression inactive at the related SF1 transcriptional activator alters the expression of haptoglobin SAA1 and SAA4 induces the death of ER negative MDA-MB-231 breast cancer cells and inhibits the StAR promoter (IC50 2.05 UM)
Cayman Chemical 5 3-AB-CHMFUPPYCA 1mg
A selective GPR55 antagonist (IC50 702 nM) selective for GPR55 over CB1 and CB2 as well as GPR35 (IC50s 32 M)
Kingfisher Biotech Inc Chicken ANG-4 Protein
The Chicken ANG-4 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken ANG-4 applications are for cell culture, ELISA standard, and Western Blot Control. Chicken ANG-4 yeast-derived recombinant protein can be purchased in multiple sizes. Chicken ANG-4 Specifications: (Molecular Weight: 13.8 kDa) (Amino Acid Sequence: QNEGYEKFLR QHYDAKPKGR DDRYCESMMK ERKLTSPCKD VNTFIHGTKK NIRAICGKKG SPYGENFRIS NSPFQITTCT HSGASPRPPC GYRAFKDFRY IVIACEDGWP VHFDESFISP (120)) (Gene ID: 100302572). For research use only. Made in the USA
Cayman Chemical AB-7-FUBAICA 1mg
A partial agonist of the dopamine D1-like receptors D1 and D5 (Kis 1 and 0 5 nM respectively)